PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G167600.1.p
Common NameSb01g014650, SORBIDRAFT_01g014650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 298aa    MW: 31361.1 Da    PI: 6.9896
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G167600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.39.9e-4271061100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC+++Cv+apyfp ++p+kf  vh++FGasnv+kll++lp+ +reda++sl+yeAear+rdPvyG+v+ i+ lq +++q
  Sobic.001G167600.1.p   7 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFSSVHRIFGASNVSKLLNELPQAQREDAVNSLAYEAEARLRDPVYGCVSYISVLQLRIKQ 95 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           +++ela++++e
  Sobic.001G167600.1.p  96 VREELAAARKE 106
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.886107IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-417104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSSSNSPCAA CKLLRRKCTQ GCVFAPYFPP DNPAKFSSVH RIFGASNVSK LLNELPQAQR  60
EDAVNSLAYE AEARLRDPVY GCVSYISVLQ LRIKQVREEL AAARKELAGY IGPAAFTPFV  120
ATPQYHHHQY AAGGVPLAAA AGMGLAVGVG PQHGHHPHHQ QQIMVHQHQH QHLHHQQMAA  180
AEAQQQLAAA VEVAREQDLM MRQAAVYAHA VPGSSGGGGG GGGATVAVVP PDAVPYEGGF  240
LFQQQPPPSQ AQTAVALTYQ MEQSPPPSSS GQSHPEVSQQ QNTDGSDEGS GGVVPPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0633092e-68BT063309.1 Zea mays full-length cDNA clone ZM_BFc0051C02 mRNA, complete cds.
GenBankKJ7277242e-68KJ727724.1 Zea mays clone pUT5664 LOB transcription factor (LOB38) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466819.10.0hypothetical protein SORBIDRAFT_01g014650
TrEMBLC5WSB60.0C5WSB6_SORBI; Putative uncharacterized protein Sb01g014650
STRINGSb01g014650.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-53ASYMMETRIC LEAVES 2-like 1